ALDH1L1 anticorps (Middle Region)
-
- Antigène Voir toutes ALDH1L1 Anticorps
- ALDH1L1 (Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALDH1L1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ALDH1 L1 antibody was raised against the middle region of ALDH1 1
- Purification
- Affinity purified
- Immunogène
- ALDH1 L1 antibody was raised using the middle region of ALDH1 1 corresponding to a region with amino acids LTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKS
- Top Product
- Discover our top product ALDH1L1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALDH1L1 Blocking Peptide, catalog no. 33R-5480, is also available for use as a blocking control in assays to test for specificity of this ALDH1L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALDH1L1 (Aldehyde Dehydrogenase 1 Family, Member L1 (ALDH1L1))
- Autre désignation
- ALDH1L1 (ALDH1L1 Produits)
- Synonymes
- anticorps 10-FTHFDH, anticorps 10-fTHF, anticorps FDH, anticorps FTHFD, anticorps Fthfd, anticorps 1810048F20Rik, anticorps Neut2, anticorps fthfd, anticorps ALDH1L1, anticorps DKFZp469C068, anticorps aldehyde dehydrogenase 1 family member L1, anticorps aldehyde dehydrogenase 1 family, member L1, anticorps cytosolic 10-formyltetrahydrofolate dehydrogenase, anticorps aldehyde dehydrogenase 1 family member L1 L homeolog, anticorps ALDH1L1, anticorps Aldh1l1, anticorps aldh1l1, anticorps LOC476506, anticorps LOC100465263, anticorps aldh1l1.L
- Sujet
- ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.
- Poids moléculaire
- 99 kDa (MW of target protein)
-