ANKS3 anticorps (N-Term)

N° du produit ABIN632034

Détail du produit anti-ANKS3 anticorps

Antigène: ANKS3 (Ankyrin Repeat and SAM Domain-Containing Protein 3 (ANKS3))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANKS3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ANKS3 antibody was raised against the N terminal of ANKS3

Purification: Affinity purified

Immunogène: ANKS3 antibody was raised using the N terminal of ANKS3 corresponding to a region with amino acids WHGLGTQVSGEELDVPLDLHTAASIGQYEVVKECVQRRELDLNKKNGGGW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANKS3 Blocking Peptide, catalog no. 33R-9953, is also available for use as a blocking control in assays to test for specificity of this ANKS3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANKS3

Antigène: ANKS3 (Ankyrin Repeat and SAM Domain-Containing Protein 3 (ANKS3))

Autre désignation: ANKS3 (ANKS3 Produits)

Synonymes: anticorps 2700067D09Rik, anticorps C81345, anticorps mKIAA1977, anticorps RGD1305833, anticorps ankyrin repeat and sterile alpha motif domain containing 3, anticorps anks3, anticorps ANKS3, anticorps Anks3

Sujet: ANKS3 contains 1 SAM (sterile alpha motif) domain and 6 ANK repeats. The exact function of ANKS3 remains unknown.

Poids moléculaire: 72 kDa (MW of target protein)