FAM13C anticorps (N-Term)

N° du produit ABIN632036

Détail du produit anti-FAM13C anticorps

Antigène: FAM13C (Family with Sequence Similarity 13, Member C (FAM13C))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM13C est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM13 C1 antibody was raised against the N terminal of FAM13 1

Purification: Affinity purified

Immunogène: FAM13 C1 antibody was raised using the N terminal of FAM13 1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM13C1 Blocking Peptide, catalog no. 33R-9039, is also available for use as a blocking control in assays to test for specificity of this FAM13C1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM13C

Antigène: FAM13C (Family with Sequence Similarity 13, Member C (FAM13C))

Autre désignation: FAM13C1 (FAM13C Produits)

Synonymes: anticorps FAM13C1, anticorps Fam13c1, anticorps RGD1310149, anticorps 1200015N20Rik, anticorps C030038O19Rik, anticorps mKIAA1796, anticorps family with sequence similarity 13 member C, anticorps family with sequence similarity 13, member C, anticorps FAM13C, anticorps Fam13c

Sujet: FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.

Poids moléculaire: 55 kDa (MW of target protein)