KIF5C anticorps (N-Term)

N° du produit ABIN632038

Détail du produit anti-KIF5C anticorps

Antigène: KIF5C (Kinesin Family Member 5C (KIF5C))

Épitope: N-Term

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF5C est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF5 C antibody was raised against the N terminal of KIF5

Purification: Affinity purified

Immunogène: KIF5 C antibody was raised using the N terminal of KIF5 corresponding to a region with amino acids TVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF5C Blocking Peptide, catalog no. 33R-9375, is also available for use as a blocking control in assays to test for specificity of this KIF5C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF5C

Antigène: KIF5C (Kinesin Family Member 5C (KIF5C))

Autre désignation: KIF5C (KIF5C Produits)

Synonymes: anticorps KIF5C, anticorps LOC100218538, anticorps KINN, anticorps NKHC, anticorps NKHC-2, anticorps NKHC2, anticorps Khc, anticorps si:ch211-157c24.3, anticorps kinesin family member 5C, anticorps KIF5C, anticorps kif5c, anticorps Kif5c

Sujet: KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.

Poids moléculaire: 109 kDa (MW of target protein)