ACBD7 anticorps (N-Term)

N° du produit ABIN632041

Détail du produit anti-ACBD7 anticorps

Antigène: ACBD7 (Acyl-CoA Binding Domain Containing 7 (ACBD7))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACBD7 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACBD7 antibody was raised against the N terminal of ACBD7

Purification: Affinity purified

Immunogène: ACBD7 antibody was raised using the N terminal of ACBD7 corresponding to a region with amino acids MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACBD7 Blocking Peptide, catalog no. 33R-5696, is also available for use as a blocking control in assays to test for specificity of this ACBD7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACBD7

Antigène: ACBD7 (Acyl-CoA Binding Domain Containing 7 (ACBD7))

Autre désignation: ACBD7 (ACBD7 Produits)

Synonymes: anticorps zgc:114176, anticorps bA455B2.2, anticorps RGD1564164, anticorps 9230116B18Rik, anticorps acyl-CoA binding domain containing 7, anticorps acyl-CoA binding domain containing 7 L homeolog, anticorps acyl-Coenzyme A binding domain containing 7, anticorps ACBD7, anticorps acbd7, anticorps acbd7.L, anticorps Acbd7

Sujet: The function of ACBD7 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 10 kDa (MW of target protein)