Phosphoglucomutase 1 anticorps (Middle Region)
-
- Antigène Voir toutes Phosphoglucomutase 1 (PGM1) Anticorps
- Phosphoglucomutase 1 (PGM1)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Phosphoglucomutase 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PGM1 antibody was raised against the middle region of PGM1
- Purification
- Affinity purified
- Immunogène
- PGM1 antibody was raised using the middle region of PGM1 corresponding to a region with amino acids ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI
- Top Product
- Discover our top product PGM1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PGM1 Blocking Peptide, catalog no. 33R-1559, is also available for use as a blocking control in assays to test for specificity of this PGM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Phosphoglucomutase 1 (PGM1)
- Autre désignation
- PGM1 (PGM1 Produits)
- Synonymes
- anticorps CDG1T, anticorps GSD14, anticorps ARABIDOPSIS THALIANA PHOSPHOGLUCOMUTASE, anticorps ATPGMP, anticorps MIO24.4, anticorps MIO24_4, anticorps PGM1, anticorps PHOSPHOGLUCOMUTASE, anticorps STARCH-FREE 1, anticorps STF1, anticorps phosphoglucomutase, anticorps PSPTO3035, anticorps CMS0426, anticorps 3230402E02Rik, anticorps Pgm-1, anticorps Pgm2, anticorps zgc:63718, anticorps phosphoglucomutase-1, anticorps pgm2, anticorps PGM, anticorps PGM 1, anticorps phosphoglucomutase 1, anticorps hypothetical protein, anticorps phosphoglucomutase, anticorps phosphoglucomutase alpha-D-glucose phosphate-specific Pgm, anticorps phosphoglucomutase, alpha-D-glucose phosphate-specific, anticorps phosphoglucomutase 1 L homeolog, anticorps PGM1, anticorps R05F9.6, anticorps PGM, anticorps pgm, anticorps STY0736, anticorps PMI_RS02700, anticorps Pgm1, anticorps pgm1, anticorps LOC542721, anticorps pgm1.L
- Sujet
- PGM1 is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose.
- Poids moléculaire
- 61 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-