AGO1 anticorps (N-Term)

N° du produit ABIN632044

Détail du produit anti-AGO1 anticorps

Antigène: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGO1 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF2 C1 antibody was raised against the N terminal of EIF2 1

Purification: Affinity purified

Immunogène: EIF2 C1 antibody was raised using the N terminal of EIF2 1 corresponding to a region with amino acids MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF2C1 Blocking Peptide, catalog no. 33R-5890, is also available for use as a blocking control in assays to test for specificity of this EIF2C1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGO1

Antigène: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Autre désignation: EIF2C1 (EIF2C1 Produits)

Synonymes: anticorps Ago, anticorps Ago-1, anticorps Ago1, anticorps CG6671, anticorps Dm Ago1, anticorps Dmel\\CG6671, anticorps MRE20, anticorps ago1, anticorps ago1-1, anticorps anon-WO0257455.29, anticorps dAGO1, anticorps dAgo1, anticorps l(2)04845, anticorps l(2)4845, anticorps l(2)k00208, anticorps l(2)k08121, anticorps GB12654, anticorps dsim_GLEANR_9718, anticorps DsimGD25729, anticorps GD25729, anticorps EIF2C1, anticorps EIF2C, anticorps GERP95, anticorps Q99, anticorps Eif2c1, anticorps ARGONAUTE 1, anticorps T1N15.2, anticorps T1N15_2, anticorps Argonaute-1, anticorps protein argonaute-2, anticorps argonaute 1, anticorps Argonaute 1, anticorps protein argonaute-1, anticorps argonaute 1, RISC catalytic component, anticorps argonaute RISC catalytic subunit 1, anticorps Stabilizer of iron transporter SufD / Polynucleotidyl transferase, anticorps AGO1, anticorps LOC552062, anticorps ago1, anticorps LOC659936, anticorps Dsim\AGO1, anticorps Ago1, anticorps LOC100386910, anticorps LOC100482671, anticorps LOC475337

Sujet: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain.

Poids moléculaire: 97 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hormone Transport, Regulation of Actin Filament Polymerization, Stem Cell Maintenance, Ribonucleoprotein Complex Subunit Organization