EN1 anticorps (C-Term)

N° du produit ABIN632046

Détail du produit anti-EN1 anticorps

Antigène: EN1 (Engrailed Homeobox 1 (EN1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: EN1 antibody was raised against the C terminal of EN1

Purification: Affinity purified

Immunogène: EN1 antibody was raised using the C terminal of EN1 corresponding to a region with amino acids LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EN1 Blocking Peptide, catalog no. 33R-5203, is also available for use as a blocking control in assays to test for specificity of this EN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EN1

Antigène: EN1 (Engrailed Homeobox 1 (EN1))

Autre désignation: EN1 (EN1 Produits)

Synonymes: anticorps EN1, anticorps En-1, anticorps Mo-en.1, anticorps ENG-1, anticorps en-1, anticorps en1, anticorps eng1, anticorps zgc:100771, anticorps en1-A, anticorps engrailed-1, anticorps xen1, anticorps Gg-En-1, anticorps en-3, anticorps engrailed, anticorps engrailed homeobox 1, anticorps engrailed 1, anticorps engrailed homeobox 1a, anticorps engrailed homeobox 1 S homeolog, anticorps EN1, anticorps En1, anticorps en1a, anticorps en1.S

Sujet: Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis