Ubiquilin 1 anticorps (Middle Region)
-
- Antigène Voir toutes Ubiquilin 1 (UBQLN1) Anticorps
- Ubiquilin 1 (UBQLN1)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Ubiquilin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Ubiquilin 1 antibody was raised against the middle region of UBQLN1
- Purification
- Affinity purified
- Immunogène
- Ubiquilin 1 antibody was raised using the middle region of UBQLN1 corresponding to a region with amino acids QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA
- Top Product
- Discover our top product UBQLN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Ubiquilin 1 Blocking Peptide, catalog no. 33R-7544, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Ubiquilin 1 (UBQLN1)
- Autre désignation
- Ubiquilin 1 (UBQLN1 Produits)
- Synonymes
- anticorps UBQLN1, anticorps DA41, anticorps DSK2, anticorps PLIC-1, anticorps UBQN, anticorps XDRP1, anticorps 1110046H03Rik, anticorps 1810030E05Rik, anticorps AU019746, anticorps C77538, anticorps D13Ertd372e, anticorps Da41, anticorps Dsk2, anticorps Plic-1, anticorps Plic1, anticorps Xdrp1, anticorps ubiquilin 1, anticorps UBQLN1, anticorps Ubqln1
- Sujet
- UBQLN1 is an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.
- Poids moléculaire
- 62 kDa (MW of target protein)
-