DCUN1D1 anticorps

N° du produit ABIN632052

Détail du produit anti-DCUN1D1 anticorps

Antigène: DCUN1D1 (Defective in Cullin Neddylation 1, Domain Containing 1 (DCUN1D1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DCUN1D1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: DCUN1 D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DCUN1D1 Blocking Peptide, catalog no. 33R-8719, is also available for use as a blocking control in assays to test for specificity of this DCUN1D1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCUN0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DCUN1D1

Antigène: DCUN1D1 (Defective in Cullin Neddylation 1, Domain Containing 1 (DCUN1D1))

Autre désignation: DCUN1D1 (DCUN1D1 Produits)

Synonymes: anticorps fd19a01, anticorps zgc:66414, anticorps wu:fd19a01, anticorps dcun1l1, anticorps rp42, anticorps sccro, anticorps scro, anticorps tes3, anticorps DCNL1, anticorps DCUN1L1, anticorps RP42, anticorps SCCRO, anticorps SCRO, anticorps Tes3, anticorps Rp42, anticorps pTes3, anticorps DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae), anticorps DCN1-like protein 1, anticorps DCN1, defective in cullin neddylation 1, domain containing 1 L homeolog, anticorps defective in cullin neddylation 1 domain containing 1, anticorps dcun1d1, anticorps dcnl1, anticorps dcun1d1.L, anticorps DCUN1D1, anticorps Dcun1d1

Sujet: DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.

Poids moléculaire: 28 kDa (MW of target protein)