UEVLD anticorps (N-Term)
-
- Antigène Voir toutes UEVLD Anticorps
- UEVLD (UEV and Lactate/malate Dehyrogenase Domains (UEVLD))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UEVLD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UEVLD antibody was raised against the N terminal of UEVLD
- Purification
- Affinity purified
- Immunogène
- UEVLD antibody was raised using the N terminal of UEVLD corresponding to a region with amino acids FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAP
- Top Product
- Discover our top product UEVLD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UEVLD Blocking Peptide, catalog no. 33R-2953, is also available for use as a blocking control in assays to test for specificity of this UEVLD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UEVLD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UEVLD (UEV and Lactate/malate Dehyrogenase Domains (UEVLD))
- Autre désignation
- UEVLD (UEVLD Produits)
- Synonymes
- anticorps ATTP, anticorps UEV3, anticorps 8430408E05Rik, anticorps Attp, anticorps UEV and lactate/malate dehyrogenase domains, anticorps UEVLD, anticorps Uevld
- Sujet
- UEVLD is a possible negative regulator of polyubiquitination.
- Poids moléculaire
- 42 kDa (MW of target protein)
-