Schlafen-Like 1 anticorps (Middle Region)
-
- Antigène Tous les produits Schlafen-Like 1 (SLFNL1)
- Schlafen-Like 1 (SLFNL1)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Schlafen-Like 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLFNL1 antibody was raised against the middle region of SLFNL1
- Purification
- Affinity purified
- Immunogène
- SLFNL1 antibody was raised using the middle region of SLFNL1 corresponding to a region with amino acids TVHTPKAQSQPQLYQTDQGEVFLRRDGSIQGPLSASAIQEWCRQRWLVEL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLFNL1 Blocking Peptide, catalog no. 33R-9355, is also available for use as a blocking control in assays to test for specificity of this SLFNL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLFNL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Schlafen-Like 1 (SLFNL1)
- Autre désignation
- SLFNL1 (SLFNL1 Produits)
- Synonymes
- anticorps 4933406A14Rik, anticorps schlafen like 1, anticorps schlafen-like 1, anticorps SLFNL1, anticorps Slfnl1
- Sujet
- SLFNL1 belongs to the Schlafen family. The function of the SLFNL1 protein remains unknown.
- Poids moléculaire
- 45 kDa (MW of target protein)
-