Schlafen-Like 1 anticorps (Middle Region)

N° du produit ABIN632057

Détail du produit anti-Schlafen-Like 1 anticorps

Antigène: Schlafen-Like 1 (SLFNL1)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Schlafen-Like 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLFNL1 antibody was raised against the middle region of SLFNL1

Purification: Affinity purified

Immunogène: SLFNL1 antibody was raised using the middle region of SLFNL1 corresponding to a region with amino acids TVHTPKAQSQPQLYQTDQGEVFLRRDGSIQGPLSASAIQEWCRQRWLVEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLFNL1 Blocking Peptide, catalog no. 33R-9355, is also available for use as a blocking control in assays to test for specificity of this SLFNL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLFNL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Schlafen-Like 1

Antigène: Schlafen-Like 1 (SLFNL1)

Autre désignation: SLFNL1 (SLFNL1 Produits)

Synonymes: anticorps 4933406A14Rik, anticorps schlafen like 1, anticorps schlafen-like 1, anticorps SLFNL1, anticorps Slfnl1

Sujet: SLFNL1 belongs to the Schlafen family. The function of the SLFNL1 protein remains unknown.

Poids moléculaire: 45 kDa (MW of target protein)