MAP3K14 anticorps (N-Term)
-
- Antigène Voir toutes MAP3K14 Anticorps
- MAP3K14 (Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAP3K14 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAP3 K14 antibody was raised against the N terminal of MAP3 14
- Purification
- Affinity purified
- Immunogène
- MAP3 K14 antibody was raised using the N terminal of MAP3 14 corresponding to a region with amino acids SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
- Top Product
- Discover our top product MAP3K14 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAP3K14 Blocking Peptide, catalog no. 33R-8382, is also available for use as a blocking control in assays to test for specificity of this MAP3K14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAP3K14 (Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14))
- Autre désignation
- MAP3K14 (MAP3K14 Produits)
- Synonymes
- anticorps FTDCR1B, anticorps HS, anticorps HSNIK, anticorps NIK, anticorps F23F1.4, anticorps F23F1_4, anticorps mitogen-activated protein kinase kinase kinase 14, anticorps Nik, anticorps aly, anticorps mitogen-activated protein kinase kinase kinase 14, anticorps MAP3K14, anticorps Map3k14, anticorps MAPKKK14
- Sujet
- This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.
- Poids moléculaire
- 104 kDa (MW of target protein)
- Pathways
- Signalisation NF-kappaB, TCR Signaling
-