AGAP2 anticorps (Middle Region)
-
- Antigène Voir toutes AGAP2 Anticorps
- AGAP2 (ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AGAP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CENTG1 antibody was raised against the middle region of CENTG1
- Purification
- Affinity purified
- Immunogène
- CENTG1 antibody was raised using the middle region of CENTG1 corresponding to a region with amino acids AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG
- Top Product
- Discover our top product AGAP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CENTG1 Blocking Peptide, catalog no. 33R-1240, is also available for use as a blocking control in assays to test for specificity of this CENTG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENTG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AGAP2 (ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2))
- Autre désignation
- CENTG1 (AGAP2 Produits)
- Synonymes
- anticorps zgc:153779, anticorps CENTG1, anticorps GGAP2, anticorps PIKE, anticorps Centg1, anticorps mKIAA0167, anticorps Pike, anticorps ArfGAP with GTPase domain, ankyrin repeat and PH domain 2, anticorps AGAP2, anticorps agap2, anticorps Agap2
- Sujet
- CENTG1 is a GTPase-activating protein (GAP) for ARF1 and ARF5, which also shows strong GTPase activity. Isoform 1 participates in the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. It also regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. It seems to be oncogenic. It is overexpressed in cancer cells, prevents apoptosis and promotes cancer cell invasion.
- Poids moléculaire
- 90 kDa (MW of target protein)
-