NECAB3 anticorps (N-Term)

N° du produit ABIN632067

Détail du produit anti-NECAB3 anticorps

Antigène: NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NECAB3 est non-conjugé

Application: Western Blotting (WB)

Specificité: NECAB3 antibody was raised against the N terminal of NECAB3

Purification: Affinity purified

Immunogène: NECAB3 antibody was raised using the N terminal of NECAB3 corresponding to a region with amino acids MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NECAB3 Blocking Peptide, catalog no. 33R-5616, is also available for use as a blocking control in assays to test for specificity of this NECAB3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NECAB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NECAB3

Antigène: NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))

Autre désignation: NECAB3 (NECAB3 Produits)

Synonymes: anticorps Apba2bp, anticorps APBA2BP, anticorps NECAB3, anticorps EFCBP3, anticorps NIP1, anticorps STIP3, anticorps SYTIP2, anticorps XB51, anticorps dJ63M2.4, anticorps dJ63M2.5, anticorps 2900010M17Rik, anticorps AI853434, anticorps Nip1, anticorps N-terminal EF-hand calcium binding protein 3, anticorps Necab3, anticorps NECAB3

Sujet: The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 44 kDa (MW of target protein)