NECAB3 anticorps (Middle Region)
-
- Antigène Voir toutes NECAB3 Anticorps
- NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NECAB3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NECAB3 antibody was raised against the middle region of NECAB3
- Purification
- Affinity purified
- Immunogène
- NECAB3 antibody was raised using the middle region of NECAB3 corresponding to a region with amino acids ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV
- Top Product
- Discover our top product NECAB3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NECAB3 Blocking Peptide, catalog no. 33R-2749, is also available for use as a blocking control in assays to test for specificity of this NECAB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NECAB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))
- Autre désignation
- NECAB3 (NECAB3 Produits)
- Synonymes
- anticorps Apba2bp, anticorps APBA2BP, anticorps NECAB3, anticorps EFCBP3, anticorps NIP1, anticorps STIP3, anticorps SYTIP2, anticorps XB51, anticorps dJ63M2.4, anticorps dJ63M2.5, anticorps 2900010M17Rik, anticorps AI853434, anticorps Nip1, anticorps N-terminal EF-hand calcium binding protein 3, anticorps Necab3, anticorps NECAB3
- Sujet
- The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.
- Poids moléculaire
- 44 kDa (MW of target protein)
-