IPPK anticorps (Middle Region)
-
- Antigène Voir toutes IPPK Anticorps
- IPPK (Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase (IPPK))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IPPK est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IPPK antibody was raised against the middle region of IPPK
- Purification
- Affinity purified
- Immunogène
- IPPK antibody was raised using the middle region of IPPK corresponding to a region with amino acids KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK
- Top Product
- Discover our top product IPPK Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IPPK Blocking Peptide, catalog no. 33R-4685, is also available for use as a blocking control in assays to test for specificity of this IPPK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IPPK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IPPK (Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase (IPPK))
- Autre désignation
- IPPK (IPPK Produits)
- Synonymes
- anticorps IPPK, anticorps MGC146756, anticorps C9orf12, anticorps INSP5K2, anticorps IP5K, anticorps IPK1, anticorps bA476B13.1, anticorps 1810043M15Rik, anticorps InsP6, anticorps RGD1311271, anticorps rIpk1, anticorps ipk1, anticorps ipk1l, anticorps si:dkey-42i9.3, anticorps zgc:110769, anticorps ATIPK1, anticorps M40H3, anticorps MJB21.19, anticorps MJB21_19, anticorps inositol-pentakisphosphate 2-kinase 1, anticorps inositol-pentakisphosphate 2-kinase, anticorps inositol 1,3,4,5,6-pentakisphosphate 2-kinase, anticorps inositol pentakisphosphate 2-kinase, anticorps inositol-pentakisphosphate 2-kinase 1, anticorps IPPK, anticorps LOC521083, anticorps ippk, anticorps Ippk, anticorps IPK1
- Sujet
- IPPK phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, non-homologous end-joining, endocytosis, ion channel regulation. It also protects cells from TNF-alpha-induced apoptosis.
- Poids moléculaire
- 56 kDa (MW of target protein)
-