PLS1 anticorps
-
- Antigène Voir toutes PLS1 Anticorps
- PLS1 (Plastin 1 (PLS1))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Plastin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY
- Top Product
- Discover our top product PLS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Plastin 1 Blocking Peptide, catalog no. 33R-4152, is also available for use as a blocking control in assays to test for specificity of this Plastin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PLS1 (Plastin 1 (PLS1))
- Autre désignation
- Plastin 1 (PLS1 Produits)
- Synonymes
- anticorps i-plastin, anticorps DKFZp459F2151, anticorps Plastin-1, anticorps wu:fi38g03, anticorps zgc:63494, anticorps AI427122, anticorps plastin 1, anticorps plastin 1 (I isoform), anticorps plastin 1 (I-isoform), anticorps PLS1, anticorps pls1, anticorps Pls1
- Sujet
- Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.
- Poids moléculaire
- 70 kDa (MW of target protein)
-