C16orf61 anticorps (Middle Region)
-
- Antigène Voir toutes C16orf61 Anticorps
- C16orf61 (Chromosome 16 Open Reading Frame 61 (C16orf61))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C16orf61 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C16 ORF61 antibody was raised against the middle region of C16 rf61
- Purification
- Affinity purified
- Immunogène
- C16 ORF61 antibody was raised using the middle region of C16 rf61 corresponding to a region with amino acids NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE
- Top Product
- Discover our top product C16orf61 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C16ORF61 Blocking Peptide, catalog no. 33R-6726, is also available for use as a blocking control in assays to test for specificity of this C16ORF61 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF61 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C16orf61 (Chromosome 16 Open Reading Frame 61 (C16orf61))
- Autre désignation
- C16ORF61 (C16orf61 Produits)
- Synonymes
- anticorps 1110046L09Rik, anticorps 2310061C15Rik, anticorps DC13, anticorps C16orf61, anticorps C18H16orf61, anticorps si:busm1-241h12.4, anticorps si:dz241h12.4, anticorps zgc:92271, anticorps C-x(9)-C motif containing 2, anticorps C-x(9)-C motif containing 2 S homeolog, anticorps COX assembly mitochondrial protein 2, anticorps C-X9-C motif containing 2, anticorps cmc2, anticorps cmc2.S, anticorps CMC2, anticorps Cmc2
- Sujet
- The function of Chromosome 16 ORF protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 9 kDa (MW of target protein)
-