FABP1 anticorps (N-Term)
-
- Antigène Voir toutes FABP1 Anticorps
- FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FABP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FABP1 antibody was raised against the N terminal of FABP1
- Purification
- Affinity purified
- Immunogène
- FABP1 antibody was raised using the N terminal of FABP1 corresponding to a region with amino acids MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF
- Top Product
- Discover our top product FABP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FABP1 Blocking Peptide, catalog no. 33R-6421, is also available for use as a blocking control in assays to test for specificity of this FABP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))
- Autre désignation
- FABP1 (FABP1 Produits)
- Sujet
- FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands.
- Poids moléculaire
- 14 kDa (MW of target protein)
- Pathways
- Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha
-