PLAC9 anticorps (Middle Region)

N° du produit ABIN632092

Détail du produit anti-PLAC9 anticorps

Antigène: PLAC9 (Placenta-Specific 9 (PLAC9))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLAC9 est non-conjugé

Application: Western Blotting (WB)

Specificité: PLAC9 antibody was raised against the middle region of PLAC9

Purification: Affinity purified

Immunogène: PLAC9 antibody was raised using the middle region of PLAC9 corresponding to a region with amino acids RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLAC9 Blocking Peptide, catalog no. 33R-8146, is also available for use as a blocking control in assays to test for specificity of this PLAC9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLAC9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLAC9

Antigène: PLAC9 (Placenta-Specific 9 (PLAC9))

Autre désignation: PLAC9 (PLAC9 Produits)

Synonymes: anticorps placenta-specific 9, anticorps placenta specific 9, anticorps Plac9, anticorps PLAC9

Sujet: The function of PLAC9 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 10 kDa (MW of target protein)