PLAC9 anticorps (Middle Region)
-
- Antigène Voir toutes PLAC9 Anticorps
- PLAC9 (Placenta-Specific 9 (PLAC9))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLAC9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PLAC9 antibody was raised against the middle region of PLAC9
- Purification
- Affinity purified
- Immunogène
- PLAC9 antibody was raised using the middle region of PLAC9 corresponding to a region with amino acids RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG
- Top Product
- Discover our top product PLAC9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PLAC9 Blocking Peptide, catalog no. 33R-8146, is also available for use as a blocking control in assays to test for specificity of this PLAC9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLAC9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PLAC9 (Placenta-Specific 9 (PLAC9))
- Autre désignation
- PLAC9 (PLAC9 Produits)
- Synonymes
- anticorps placenta-specific 9, anticorps placenta specific 9, anticorps Plac9, anticorps PLAC9
- Sujet
- The function of PLAC9 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 10 kDa (MW of target protein)
-