MDP1 anticorps (N-Term)
-
- Antigène Voir toutes MDP1 Anticorps
- MDP1 (Magnesium-Dependent Phosphatase 1 (MDP1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MDP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MDP1 antibody was raised against the N terminal Of Mdp-1
- Purification
- Affinity purified
- Immunogène
- MDP1 antibody was raised using the N terminal Of Mdp-1 corresponding to a region with amino acids MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE
- Top Product
- Discover our top product MDP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MDP1 Blocking Peptide, catalog no. 33R-5731, is also available for use as a blocking control in assays to test for specificity of this MDP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDP-1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MDP1 (Magnesium-Dependent Phosphatase 1 (MDP1))
- Autre désignation
- MDP1 (MDP1 Produits)
- Synonymes
- anticorps MGC133592, anticorps FN6PASE, anticorps MDP-1, anticorps 1810034K20Rik, anticorps AI035604, anticorps Mdp-1, anticorps RGD1311147, anticorps magnesium-dependent phosphatase 1, anticorps magnesium dependent phosphatase 1, anticorps Magnesium-dependent phosphatase 1, anticorps LOC480264, anticorps MDP1, anticorps Mdp1, anticorps mgdp1
- Sujet
- MDP-1 is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase.
- Poids moléculaire
- 20 kDa (MW of target protein)
-