MDP1 anticorps (N-Term)

N° du produit ABIN632094

Détail du produit anti-MDP1 anticorps

Antigène: MDP1 (Magnesium-Dependent Phosphatase 1 (MDP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MDP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MDP1 antibody was raised against the N terminal Of Mdp-1

Purification: Affinity purified

Immunogène: MDP1 antibody was raised using the N terminal Of Mdp-1 corresponding to a region with amino acids MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MDP1 Blocking Peptide, catalog no. 33R-5731, is also available for use as a blocking control in assays to test for specificity of this MDP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDP-1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MDP1

Antigène: MDP1 (Magnesium-Dependent Phosphatase 1 (MDP1))

Autre désignation: MDP1 (MDP1 Produits)

Synonymes: anticorps MGC133592, anticorps FN6PASE, anticorps MDP-1, anticorps 1810034K20Rik, anticorps AI035604, anticorps Mdp-1, anticorps RGD1311147, anticorps magnesium-dependent phosphatase 1, anticorps magnesium dependent phosphatase 1, anticorps Magnesium-dependent phosphatase 1, anticorps LOC480264, anticorps MDP1, anticorps Mdp1, anticorps mgdp1

Sujet: MDP-1 is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase.

Poids moléculaire: 20 kDa (MW of target protein)