PPM1J anticorps

N° du produit ABIN632095

Détail du produit anti-PPM1J anticorps

Antigène: PPM1J (Protein Phosphatase 1J (PPM1J))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPM1J est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PPM1 J antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPM1J Blocking Peptide, catalog no. 33R-9070, is also available for use as a blocking control in assays to test for specificity of this PPM1J antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPM1J

Antigène: PPM1J (Protein Phosphatase 1J (PPM1J))

Autre désignation: PPM1J (PPM1J Produits)

Synonymes: anticorps 2310008J22Rik, anticorps PP2Czeta, anticorps Ppp2cz, anticorps PP2CZ, anticorps PPP2CZ, anticorps protein phosphatase 1J, anticorps protein phosphatase, Mg2+/Mn2+ dependent 1J, anticorps protein phosphatase, Mg2+/Mn2+ dependent, 1J, anticorps Ppm1j, anticorps PPM1J

Sujet: PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known.

Poids moléculaire: 55 kDa (MW of target protein)