Septin 9 anticorps (Middle Region)
-
- Antigène Voir toutes Septin 9 (SEPT9) Anticorps
- Septin 9 (SEPT9)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Septin 9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Septin 9 antibody was raised against the middle region of SEPT9
- Purification
- Affinity purified
- Immunogène
- Septin 9 antibody was raised using the middle region of SEPT9 corresponding to a region with amino acids VNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYL
- Top Product
- Discover our top product SEPT9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Septin 9 Blocking Peptide, catalog no. 33R-9702, is also available for use as a blocking control in assays to test for specificity of this Septin 9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40057 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Septin 9 (SEPT9)
- Autre désignation
- Septin 9 (SEPT9 Produits)
- Synonymes
- anticorps SEPT9, anticorps msf, anticorps msf1, anticorps napb, anticorps sint1, anticorps pnutl4, anticorps septd1, anticorps af17q25, anticorps septin-9, anticorps AF17q25, anticorps MSF, anticorps MSF1, anticorps NAPB, anticorps PNUTL4, anticorps SINT1, anticorps SeptD1, anticorps Msf, anticorps Sint1, anticorps Eseptin, anticorps Slpa, anticorps cb999, anticorps fb02h06, anticorps sept9, anticorps wu:fb02h06, anticorps septin 9, anticorps septin-9, anticorps septin 9 S homeolog, anticorps septin 9a, anticorps SEPT9, anticorps sept9, anticorps LOC100605286, anticorps sept9.S, anticorps Sept9, anticorps sept9a
- Sujet
- This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.
- Poids moléculaire
- 46 kDa (MW of target protein)
-