ASXL2 anticorps
-
- Antigène Voir toutes ASXL2 Anticorps
- ASXL2 (Additional Sex Combs Like 2 (ASXL2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ASXL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ASXL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS
- Top Product
- Discover our top product ASXL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ASXL2 Blocking Peptide, catalog no. 33R-2337, is also available for use as a blocking control in assays to test for specificity of this ASXL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASXL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ASXL2 (Additional Sex Combs Like 2 (ASXL2))
- Autre désignation
- ASXL2 (ASXL2 Produits)
- Synonymes
- anticorps asxh2, anticorps ASXH2, anticorps 4930556B16Rik, anticorps mKIAA1685, anticorps additional sex combs like 2, transcriptional regulator, anticorps additional sex combs like 2 (Drosophila), anticorps Asxl2, anticorps ASXL2, anticorps asxl2
- Sujet
- ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax and polycomb gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing.
- Poids moléculaire
- 154 kDa (MW of target protein)
- Pathways
- Positive Regulation of fat Cell Differentiation
-