Acylglycerol Kinase anticorps (N-Term)

N° du produit ABIN632105

Détail du produit anti-Acylglycerol Kinase anticorps

Antigène: Acylglycerol Kinase (AGK)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Acylglycerol Kinase est non-conjugé

Application: Western Blotting (WB)

Specificité: AGK antibody was raised against the N terminal of AGK

Purification: Affinity purified

Immunogène: AGK antibody was raised using the N terminal of AGK corresponding to a region with amino acids KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AGK Blocking Peptide, catalog no. 33R-4482, is also available for use as a blocking control in assays to test for specificity of this AGK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Acylglycerol Kinase

Antigène: Acylglycerol Kinase (AGK)

Autre désignation: AGK (AGK Produits)

Synonymes: anticorps mulk, anticorps CATC5, anticorps CTRCT38, anticorps MTDPS10, anticorps MULK, anticorps 2610037M15Rik, anticorps 6720408I04Rik, anticorps AI465370, anticorps Mulk, anticorps RGD1562046, anticorps fi38e09, anticorps wu:fi38e09, anticorps zgc:55462, anticorps acylglycerol kinase, anticorps acylglycerol kinase S homeolog, anticorps AGK, anticorps agk, anticorps LOC100165096, anticorps Agk, anticorps agk.S

Sujet: AGK is a lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. AGK does not phosphorylate sphingosine. Overexpression of AGK increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK signaling pathway, leading to increased cell growth.

Poids moléculaire: 47 kDa (MW of target protein)