Acylglycerol Kinase anticorps (N-Term)
-
- Antigène Voir toutes Acylglycerol Kinase (AGK) Anticorps
- Acylglycerol Kinase (AGK)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Acylglycerol Kinase est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AGK antibody was raised against the N terminal of AGK
- Purification
- Affinity purified
- Immunogène
- AGK antibody was raised using the N terminal of AGK corresponding to a region with amino acids KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE
- Top Product
- Discover our top product AGK Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AGK Blocking Peptide, catalog no. 33R-4482, is also available for use as a blocking control in assays to test for specificity of this AGK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Acylglycerol Kinase (AGK)
- Autre désignation
- AGK (AGK Produits)
- Sujet
- AGK is a lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. AGK does not phosphorylate sphingosine. Overexpression of AGK increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK signaling pathway, leading to increased cell growth.
- Poids moléculaire
- 47 kDa (MW of target protein)
-