EPRS anticorps (Middle Region)
-
- Antigène Voir toutes EPRS Anticorps
- EPRS (Glutamyl-Prolyl-tRNA Synthetase (EPRS))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EPRS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EPRS antibody was raised against the middle region of EPRS
- Purification
- Affinity purified
- Immunogène
- EPRS antibody was raised using the middle region of EPRS corresponding to a region with amino acids GKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCEL
- Top Product
- Discover our top product EPRS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EPRS Blocking Peptide, catalog no. 33R-3367, is also available for use as a blocking control in assays to test for specificity of this EPRS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPRS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EPRS (Glutamyl-Prolyl-tRNA Synthetase (EPRS))
- Autre désignation
- EPRS (EPRS Produits)
- Synonymes
- anticorps EARS, anticorps GLUPRORS, anticorps PARS, anticorps QARS, anticorps QPRS, anticorps wu:fb38d08, anticorps wu:ft34d10, anticorps 2410081F06Rik, anticorps 3010002K18Rik, anticorps C79379, anticorps Qprs, anticorps glutamyl-prolyl-tRNA synthetase, anticorps glutamyl-prolyl-tRNA synthetase S homeolog, anticorps EPRS, anticorps eprs, anticorps eprs.S, anticorps Eprs
- Sujet
- The protein encoded by this gene is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. Alternative splicing has been observed for this gene, but the full-length nature and biological validity of the variant have not been determined.
- Poids moléculaire
- 170 kDa (MW of target protein)
-