LIX1L anticorps

N° du produit ABIN632112

Détail du produit anti-LIX1L anticorps

Antigène: LIX1L (Lix1 Homolog Like (LIX1L))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIX1L est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LIX1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIX1L Blocking Peptide, catalog no. 33R-1225, is also available for use as a blocking control in assays to test for specificity of this LIX1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIX0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIX1L

Antigène: LIX1L (Lix1 Homolog Like (LIX1L))

Autre désignation: LIX1L (LIX1L Produits)

Synonymes: anticorps si:ch211-210h11.10, anticorps D130027M04Rik, anticorps limb and CNS expressed 1 like, anticorps Lix1-like, anticorps lix1l, anticorps LIX1L, anticorps Lix1l

Sujet: LIX1L may function as a modulator of fat signaling.

Poids moléculaire: 36 kDa (MW of target protein)