WDTC1 anticorps (N-Term)

N° du produit ABIN632114

Détail du produit anti-WDTC1 anticorps

Antigène: WDTC1 (Wdtc1) (WD and Tetratricopeptide Repeats 1 (Wdtc1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDTC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDTC1 antibody was raised against the N terminal of WDTC1

Purification: Affinity purified

Immunogène: WDTC1 antibody was raised using the N terminal of WDTC1 corresponding to a region with amino acids PMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDTC1 Blocking Peptide, catalog no. 33R-7230, is also available for use as a blocking control in assays to test for specificity of this WDTC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDTC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDTC1

Antigène: WDTC1 (Wdtc1) (WD and Tetratricopeptide Repeats 1 (Wdtc1))

Autre désignation: WDTC1 (Wdtc1 Produits)

Synonymes: anticorps fc31b01, anticorps wu:fc31b01, anticorps zgc:194983, anticorps ADP, anticorps DCAF9, anticorps Gm695, anticorps adipose, anticorps adp, anticorps WD and tetratricopeptide repeats 1, anticorps WD and tetratricopeptide repeats 1 L homeolog, anticorps WDTC1, anticorps wdtc1, anticorps wdtc1.L, anticorps Wdtc1

Sujet: WDTC1 contains 2 TPR repeats and 7 WD repeats. WDTC1, the ortholog of Drosophila Adipose Gene, associates with human obesity, modulated by MUFA intake.

Poids moléculaire: 76 kDa (MW of target protein)