CCDC69 anticorps (Middle Region)

N° du produit ABIN632117

Détail du produit anti-CCDC69 anticorps

Antigène: CCDC69 (Coiled-Coil Domain Containing 69 (CCDC69))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC69 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC69 antibody was raised against the middle region of CCDC69

Purification: Affinity purified

Immunogène: CCDC69 antibody was raised using the middle region of CCDC69 corresponding to a region with amino acids TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC69 Blocking Peptide, catalog no. 33R-9255, is also available for use as a blocking control in assays to test for specificity of this CCDC69 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC69 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC69

Antigène: CCDC69 (Coiled-Coil Domain Containing 69 (CCDC69))

Autre désignation: CCDC69 (CCDC69 Produits)

Synonymes: anticorps ccdc69, anticorps MGC83627, anticorps MGC147153, anticorps 2210021E03Rik, anticorps D11Ertd461e, anticorps RGD1562251, anticorps coiled-coil domain containing 69, anticorps coiled-coil domain containing 69 S homeolog, anticorps coiled-coil domain containing 69 L homeolog, anticorps CCDC69, anticorps ccdc69.S, anticorps ccdc69, anticorps ccdc69.L, anticorps Ccdc69

Sujet: The function of CCDC69 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 35 kDa (MW of target protein)