SSBP3 anticorps (Middle Region)

N° du produit ABIN632119

Détail du produit anti-SSBP3 anticorps

Antigène: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SSBP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: SSBP3 antibody was raised against the middle region of SSBP3

Purification: Affinity purified

Immunogène: SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SSBP3 Blocking Peptide, catalog no. 33R-1990, is also available for use as a blocking control in assays to test for specificity of this SSBP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSBP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SSBP3

Antigène: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Autre désignation: SSBP3 (SSBP3 Produits)

Synonymes: anticorps ssbp3, anticorps MGC75859, anticorps SSBP3, anticorps SSDP1b, anticorps si:dkey-63k7.6, anticorps csdp, anticorps ssdp, anticorps ssdp1, anticorps CSDP, anticorps SSDP, anticorps SSDP1, anticorps Ssdp, anticorps Ssdp3, anticorps SSDP1a, anticorps id:ibd1109, anticorps zgc:63791, anticorps 2610021L12Rik, anticorps 2610200M23Rik, anticorps 5730488C10Rik, anticorps AI854733, anticorps AW551939, anticorps LAST, anticorps single stranded DNA binding protein 3, anticorps single stranded DNA binding protein 3a, anticorps single stranded DNA binding protein 3 L homeolog, anticorps single stranded DNA binding protein 3b, anticorps single-stranded DNA binding protein 3, anticorps ssbp3, anticorps SSBP3, anticorps ssbp3a, anticorps ssbp3.L, anticorps Ssbp3, anticorps ssbp3b

Sujet: SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Poids moléculaire: 38 kDa (MW of target protein)