UFSP2 anticorps (Middle Region)
-
- Antigène Voir toutes UFSP2 (C4orf20) Anticorps
- UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UFSP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C4 ORF20 antibody was raised against the middle region of C4 rf20
- Purification
- Affinity purified
- Immunogène
- C4 ORF20 antibody was raised using the middle region of C4 rf20 corresponding to a region with amino acids TPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVILEKGWC
- Top Product
- Discover our top product C4orf20 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C4ORF20 Blocking Peptide, catalog no. 33R-9238, is also available for use as a blocking control in assays to test for specificity of this C4ORF20 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))
- Autre désignation
- C4ORF20 (C4orf20 Produits)
- Synonymes
- anticorps C4orf20, anticorps 1810047C23Rik, anticorps RGD1311161, anticorps cb891, anticorps fb05c06, anticorps fk89d04, anticorps wu:fb05c06, anticorps wu:fk89d04, anticorps zgc:64113, anticorps UFM1 specific peptidase 2, anticorps UFM1-specific peptidase 2, anticorps UFM1-specific peptidase 2 L homeolog, anticorps ufm1-specific peptidase 2, anticorps UFSP2, anticorps Ufsp2, anticorps ufsp2.L, anticorps ufsp2
- Sujet
- C4ORF20 is a thiol protease which recognises and hydrolyzes the peptide bond at the C-terminal Gly of UFM1, an ubiquitin-like modifier protein bound to a number of target proteins. Does not hydrolyze SUMO1 or ISG15 ubiquitin-like proteins.
- Poids moléculaire
- 53 kDa (MW of target protein)
-