ANKMY2 anticorps (N-Term)

N° du produit ABIN632127

Détail du produit anti-ANKMY2 anticorps

Antigène: ANKMY2 (Ankyrin Repeat and MYND Domain Containing 2 (ANKMY2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANKMY2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ANKMY2 antibody was raised against the N terminal of ANKMY2

Purification: Affinity purified

Immunogène: ANKMY2 antibody was raised using the N terminal of ANKMY2 corresponding to a region with amino acids DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANKMY2 Blocking Peptide, catalog no. 33R-2226, is also available for use as a blocking control in assays to test for specificity of this ANKMY2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKMY2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANKMY2

Antigène: ANKMY2 (Ankyrin Repeat and MYND Domain Containing 2 (ANKMY2))

Autre désignation: ANKMY2 (ANKMY2 Produits)

Synonymes: anticorps ZMYND20, anticorps AI035571, anticorps Gna14, anticorps ankmy2, anticorps si:dkeyp-25a3.5, anticorps fi46e08, anticorps wu:fi46e08, anticorps zgc:55491, anticorps ankyrin repeat and MYND domain containing 2, anticorps ankyrin repeat and MYND domain containing 2b, anticorps ankyrin repeat and MYND domain containing 2a, anticorps ANKMY2, anticorps Ankmy2, anticorps ankmy2b, anticorps ankmy2a

Sujet: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 49 kDa (MW of target protein)