VGLL3 anticorps
-
- Antigène Voir toutes VGLL3 Anticorps
- VGLL3 (Vestigial Like 3 (VGLL3))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VGLL3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- VGLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY
- Top Product
- Discover our top product VGLL3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VGLL3 Blocking Peptide, catalog no. 33R-1663, is also available for use as a blocking control in assays to test for specificity of this VGLL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VGLL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VGLL3 (Vestigial Like 3 (VGLL3))
- Autre désignation
- VGLL3 (VGLL3 Produits)
- Synonymes
- anticorps RGD1560030, anticorps VGL-3, anticorps VGL3, anticorps 1700110N18Rik, anticorps 4832416J22, anticorps C80713, anticorps Vgl-3, anticorps Vito-2, anticorps vestigial-like family member 3, anticorps vestigial like family member 3, anticorps Vgll3, anticorps VGLL3
- Sujet
- VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.
- Poids moléculaire
- 36 kDa (MW of target protein)
-