SFRP2 anticorps (Middle Region)
-
- Antigène Voir toutes SFRP2 Anticorps
- SFRP2 (Secreted Frizzled-Related Protein 2 (SFRP2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SFRP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SFRP2 antibody was raised against the middle region of SFRP2
- Purification
- Affinity purified
- Immunogène
- SFRP2 antibody was raised using the middle region of SFRP2 corresponding to a region with amino acids DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN
- Top Product
- Discover our top product SFRP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SFRP2 Blocking Peptide, catalog no. 33R-2142, is also available for use as a blocking control in assays to test for specificity of this SFRP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SFRP2 (Secreted Frizzled-Related Protein 2 (SFRP2))
- Autre désignation
- SFRP2 (SFRP2 Produits)
- Synonymes
- anticorps frp-2, anticorps sarp1, anticorps sdf-5, anticorps sfrp-2, anticorps SFRP2, anticorps sfrp2, anticorps FRP-2, anticorps SARP1, anticorps SDF-5, anticorps AI851596, anticorps Sdf5, anticorps hm:zeh0225, anticorps zeh0225, anticorps zgc:153618, anticorps SFRP-2, anticorps secreted frizzled-related protein 2, anticorps secreted frizzled related protein 2, anticorps secreted frizzled-related protein 2 S homeolog, anticorps secreted frizzled-related protein, anticorps sfrp2, anticorps sfrp2, anticorps SFRP2, anticorps sfrp2.S, anticorps LOAG_01461, anticorps Sfrp2
- Sujet
- SFRP2 is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.
- Poids moléculaire
- 31 kDa (MW of target protein)
- Pathways
- Signalisation WNT, Tube Formation, Positive Regulation of Endopeptidase Activity, Negative Regulation of intrinsic apoptotic Signaling, Positive Regulation of fat Cell Differentiation
-