CCDC63 anticorps (Middle Region)

N° du produit ABIN632141

Détail du produit anti-CCDC63 anticorps

Antigène: CCDC63 (Coiled-Coil Domain Containing 63 (CCDC63))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC63 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC63 antibody was raised against the middle region of CCDC63

Purification: Affinity purified

Immunogène: CCDC63 antibody was raised using the middle region of CCDC63 corresponding to a region with amino acids EQSSQAYEQRVEAMARMAAMKDRQKKDTSQYNLEIRELERLYAHESKLKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC63 Blocking Peptide, catalog no. 33R-2679, is also available for use as a blocking control in assays to test for specificity of this CCDC63 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC63 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC63

Antigène: CCDC63 (Coiled-Coil Domain Containing 63 (CCDC63))

Autre désignation: CCDC63 (CCDC63 Produits)

Synonymes: anticorps ODA5, anticorps 4921511C16Rik, anticorps coiled-coil domain containing 63, anticorps CCDC63, anticorps Ccdc63

Sujet: The function of CCDC63 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 66 kDa (MW of target protein)