EPS8-Like 1 anticorps (Middle Region)
-
- Antigène Voir toutes EPS8-Like 1 (EPS8L1) Anticorps
- EPS8-Like 1 (EPS8L1)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EPS8-Like 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EPS8 L1 antibody was raised against the middle region of EPS8 1
- Purification
- Affinity purified
- Immunogène
- EPS8 L1 antibody was raised using the middle region of EPS8 1 corresponding to a region with amino acids LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG
- Top Product
- Discover our top product EPS8L1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EPS8L1 Blocking Peptide, catalog no. 33R-5318, is also available for use as a blocking control in assays to test for specificity of this EPS8L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPS0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EPS8-Like 1 (EPS8L1)
- Autre désignation
- EPS8L1 (EPS8L1 Produits)
- Synonymes
- anticorps EPS8L1, anticorps drc3, anticorps eps8r1, anticorps DRC3, anticorps EPS8R1, anticorps 2310051G19Rik, anticorps 4632407K17Rik, anticorps AW060268, anticorps zgc:113583, anticorps EPS8 like 1, anticorps EPS8-like 1, anticorps EPS8 like 1 L homeolog, anticorps eps8-like1, anticorps EPS8L1, anticorps eps8l1, anticorps eps8l1.L, anticorps Eps8l1
- Sujet
- EPS8L1 a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown.
- Poids moléculaire
- 66 kDa (MW of target protein)
-