MAT2B anticorps (N-Term)

N° du produit ABIN632144

Détail du produit anti-MAT2B anticorps

Antigène: MAT2B (Methionine Adenosyltransferase II, beta (MAT2B))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAT2B est non-conjugé

Application: Western Blotting (WB)

Specificité: MAT2 B antibody was raised against the N terminal of MAT2

Purification: Affinity purified

Immunogène: MAT2 B antibody was raised using the N terminal of MAT2 corresponding to a region with amino acids KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAT2B Blocking Peptide, catalog no. 33R-4332, is also available for use as a blocking control in assays to test for specificity of this MAT2B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAT2B

Antigène: MAT2B (Methionine Adenosyltransferase II, beta (MAT2B))

Autre désignation: MAT2B (MAT2B Produits)

Synonymes: anticorps MAT-II, anticorps MATIIbeta, anticorps Nbla02999, anticorps SDR23E1, anticorps TGR, anticorps 1110064C04Rik, anticorps 2410018D16Rik, anticorps AI182287, anticorps AU022853, anticorps fc55d01, anticorps wu:fb48h02, anticorps wu:fc55d01, anticorps zgc:110308, anticorps MAT2beta, anticorps methionine adenosyltransferase 2B, anticorps methionine adenosyltransferase II, beta, anticorps methionine adenosyltransferase II, beta L homeolog, anticorps MAT2B, anticorps Mat2b, anticorps mat2b, anticorps mat2b.L

Sujet: MAT2B belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process, SARS-CoV-2 Protein Interactome