ITPK1 anticorps (N-Term)

N° du produit ABIN632148

Détail du produit anti-ITPK1 anticorps

Antigène: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITPK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ITPK1 antibody was raised against the N terminal of ITPK1

Purification: Affinity purified

Immunogène: ITPK1 antibody was raised using the N terminal of ITPK1 corresponding to a region with amino acids MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ITPK1 Blocking Peptide, catalog no. 33R-5984, is also available for use as a blocking control in assays to test for specificity of this ITPK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITPK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ITPK1

Antigène: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Autre désignation: ITPK1 (ITPK1 Produits)

Synonymes: anticorps ITRPK1, anticorps BC031182, anticorps wu:fj15d08, anticorps zgc:56075, anticorps inositol-tetrakisphosphate 1-kinase, anticorps inositol 1,3,4-triphosphate 5/6 kinase, anticorps inositol-tetrakisphosphate 1-kinase L homeolog, anticorps inositol-tetrakisphosphate 1-kinase a, anticorps ITPK1, anticorps Itpk1, anticorps itpk1.L, anticorps itpk1a

Sujet: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. It probably acts as the rate-limiting enzyme of the InsP6 pathway. ITPK1 modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain.

Poids moléculaire: 45 kDa (MW of target protein)