ERP44 anticorps
-
- Antigène Voir toutes ERP44 Anticorps
- ERP44 (Endoplasmic Reticulum Protein 44 (ERP44))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ERP44 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TXNDC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE
- Top Product
- Discover our top product ERP44 Anticorps primaire
-
anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 1-406) antibody
ERP44 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-406) antibodyERP44 Reactivité: Humain WB, ELISA, IHC (p), IP Hôte: Souris Monoclonal 3C7 unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (Internal Region) antibodyERP44 Reactivité: Humain, Souris, Rat, Lapin, Boeuf (Vache), Chien, Cheval, Singe, Cobaye, Porc, Roussette (Chauve-souris), Poulet, Xenopus laevis IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 30-407) antibodyERP44 Reactivité: Humain WB, IHC, ELISA, IHC (p), IP Hôte: Souris Monoclonal 3C7 unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) antibodyERP44 Reactivité: Humain, Souris WB, IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) antibodyERP44 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (AA 57-406) antibodyERP44 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (Internal Region) antibodyVerified ERP44 Reactivité: Humain WB, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (C-Term) antibodyERP44 Reactivité: Humain, Souris, Rat, Cobaye, Porc, Poisson zèbre (Danio rerio) WB Hôte: Lapin Polyclonal unconjugated
anti-Endoplasmic Reticulum Protein 44 (ERP44) (C-Term) antibodyERP44 Reactivité: Humain IHC (p) Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TXNDC4 Blocking Peptide, catalog no. 33R-5025, is also available for use as a blocking control in assays to test for specificity of this TXNDC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ERP44 (Endoplasmic Reticulum Protein 44 (ERP44))
- Autre désignation
- TXNDC4 (ERP44 Produits)
- Synonymes
- anticorps PDIA10, anticorps TXNDC4, anticorps 1110001E24Rik, anticorps AI849526, anticorps AL033348, anticorps Txndc4, anticorps BWK4, anticorps txndc4, anticorps zgc:77883, anticorps endoplasmic reticulum protein 44, anticorps ERP44, anticorps Erp44, anticorps erp44
- Sujet
- TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.
- Poids moléculaire
- 45 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis, SARS-CoV-2 Protein Interactome
-
