EIF3E anticorps (N-Term)
-
- Antigène Voir toutes EIF3E Anticorps
- EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF3E est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EIF3 E antibody was raised against the N terminal of EIF3
- Purification
- Affinity purified
- Immunogène
- EIF3 E antibody was raised using the N terminal of EIF3 corresponding to a region with amino acids ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ
- Top Product
- Discover our top product EIF3E Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EIF3E Blocking Peptide, catalog no. 33R-2557, is also available for use as a blocking control in assays to test for specificity of this EIF3E antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))
- Autre désignation
- EIF3E (EIF3E Produits)
- Synonymes
- anticorps EIF3-P48, anticorps EIF3S6, anticorps INT6, anticorps eIF3-p46, anticorps 48kDa, anticorps Eif3s6, anticorps Int6, anticorps eIF3-p48, anticorps eif3-p48, anticorps eif3s6, anticorps eif3s6-A, anticorps eIF3e, anticorps eIF3-S6, anticorps eif3s6-B, anticorps EIF3SE, anticorps eif3s6b, anticorps im:7147439, anticorps QtsA-18056, anticorps eukaryotic translation initiation factor 3 subunit E, anticorps eukaryotic translation initiation factor 3, subunit E, anticorps eukaryotic translation initiation factor 3 subunit E L homeolog, anticorps eukaryotic translation initiation factor 3 subunit 6, anticorps eukaryotic translation initiation factor 3 subunit E S homeolog, anticorps eukaryotic translation initiation factor 3, subunit E, a, anticorps Eukaryotic translation initiation factor 3 subunit E, anticorps eukaryotic translation initiation factor 3, subunit E, b, anticorps EIF3E, anticorps Eif3e, anticorps eif3e, anticorps eif3e.L, anticorps LOC692936, anticorps eif3e.S, anticorps eif3ea, anticorps eif-3.E, anticorps eif3eb, anticorps LOC108348260, anticorps int6
- Sujet
- EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD), It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Hepatitis C
-