C14orf174 anticorps (N-Term)
-
- Antigène Tous les produits C14orf174
- C14orf174 (Chromosome 14 Open Reading Frame 174 (C14orf174))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C14orf174 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C14 ORF174 antibody was raised against the N terminal Of C14 rf174
- Purification
- Affinity purified
- Immunogène
- C14 ORF174 antibody was raised using the N terminal Of C14 rf174 corresponding to a region with amino acids FPSEKLGESLEETDLQPPKMTKPETPEETQRESTEKKRTEPPEQARLEFL
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C14ORF174 Blocking Peptide, catalog no. 33R-3024, is also available for use as a blocking control in assays to test for specificity of this C14ORF174 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF174 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C14orf174 (Chromosome 14 Open Reading Frame 174 (C14orf174))
- Autre désignation
- C14ORF174 (C14orf174 Produits)
- Synonymes
- anticorps C14orf174, anticorps FAM15A, anticorps Gm263, anticorps sterile alpha motif domain containing 15, anticorps SAMD15, anticorps Samd15
- Sujet
- C14orf174 contains 1 SAM (sterile alpha motif) domain. The exact functions of C14orf174 remain unknown.
- Poids moléculaire
- 77 kDa (MW of target protein)
-