Tektin 4 anticorps (N-Term)

N° du produit ABIN632168

Détail du produit anti-Tektin 4 anticorps

Antigène: Tektin 4 (TEKT4)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tektin 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: Tektin 4 antibody was raised against the N terminal of TEKT4

Purification: Affinity purified

Immunogène: Tektin 4 antibody was raised using the N terminal of TEKT4 corresponding to a region with amino acids LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tektin 4 Blocking Peptide, catalog no. 33R-4802, is also available for use as a blocking control in assays to test for specificity of this Tektin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEKT4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tektin 4

Antigène: Tektin 4 (TEKT4)

Autre désignation: Tektin 4 (TEKT4 Produits)

Synonymes: anticorps ECGP, anticorps GP96, anticorps GRP94, anticorps TRA1, anticorps 1700010L19Rik, anticorps RGD1308075, anticorps Tek4, anticorps Tektin4, anticorps Tekt4, anticorps heat shock protein 90 beta family member 1, anticorps tektin 4, anticorps tektin-4, anticorps tektin 4 S homeolog, anticorps HSP90B1, anticorps Tekt4, anticorps TEKT4, anticorps LOC490081, anticorps tekt4.S, anticorps tekt4, anticorps LOC100719827, anticorps LOC110259951

Sujet: TEKT4 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules.

Poids moléculaire: 51 kDa (MW of target protein)