LIX1 anticorps

N° du produit ABIN632169

Détail du produit anti-LIX1 anticorps

Antigène: LIX1 (Lix1 Homolog (LIX1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIX1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LIX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIX1 Blocking Peptide, catalog no. 33R-9181, is also available for use as a blocking control in assays to test for specificity of this LIX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIX1

Antigène: LIX1 (Lix1 Homolog (LIX1))

Autre désignation: LIX1 (LIX1 Produits)

Synonymes: anticorps 5730466L18Rik, anticorps si:ch211-236k19.8, anticorps C5orf11, anticorps limb and CNS expressed 1, anticorps Lix1, anticorps LIX1, anticorps lix1

Sujet: The function of LIX1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 32 kDa (MW of target protein)