TCTE1 anticorps (Middle Region)

N° du produit ABIN632172

Détail du produit anti-TCTE1 anticorps

Antigène: TCTE1 (T-Complex-Associated-Testis-Expressed 1 (TCTE1))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TCTE1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TCTE1 antibody was raised against the middle region of TCTE1

Purification: Affinity purified

Immunogène: TCTE1 antibody was raised using the middle region of TCTE1 corresponding to a region with amino acids MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TCTE1 Blocking Peptide, catalog no. 33R-6244, is also available for use as a blocking control in assays to test for specificity of this TCTE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TCTE1

Antigène: TCTE1 (T-Complex-Associated-Testis-Expressed 1 (TCTE1))

Autre désignation: TCTE1 (TCTE1 Produits)

Synonymes: anticorps D17Sil1, anticorps Tcte-1, anticorps D6S46, anticorps t-complex-associated-testis-expressed 1, anticorps t-complex-associated testis expressed 1, anticorps TCTE1, anticorps Tcte1

Sujet: TCTE1 contains 7 LRR (leucine-rich) repeats. The exact function of TCTE1 remains unknown.

Poids moléculaire: 56 kDa (MW of target protein)