PRRC2B anticorps (N-Term)
-
- Antigène Voir toutes PRRC2B Anticorps
- PRRC2B (Proline-Rich Coiled-Coil 2B (PRRC2B))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRRC2B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KIAA0515 antibody was raised against the N terminal of KIAA0515
- Purification
- Affinity purified
- Immunogène
- KIAA0515 antibody was raised using the N terminal of KIAA0515 corresponding to a region with amino acids ATASQPPESLPQPGLQKSVSNLQKPTQSISQENTNSVPGGPKSWAQLNGK
- Top Product
- Discover our top product PRRC2B Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIAA0515 Blocking Peptide, catalog no. 33R-1551, is also available for use as a blocking control in assays to test for specificity of this KIAA0515 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0515 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRRC2B (Proline-Rich Coiled-Coil 2B (PRRC2B))
- Autre désignation
- KIAA0515 (PRRC2B Produits)
- Sujet
- The function of KIAA0515 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-