PRRC2B anticorps (N-Term)

N° du produit ABIN632176

Détail du produit anti-PRRC2B anticorps

Antigène: PRRC2B (Proline-Rich Coiled-Coil 2B (PRRC2B))

Épitope: N-Term

Reactivité: Souris, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRRC2B est non-conjugé

Application: Western Blotting (WB)

Specificité: KIAA0515 antibody was raised against the N terminal of KIAA0515

Purification: Affinity purified

Immunogène: KIAA0515 antibody was raised using the N terminal of KIAA0515 corresponding to a region with amino acids ATASQPPESLPQPGLQKSVSNLQKPTQSISQENTNSVPGGPKSWAQLNGK

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA0515 Blocking Peptide, catalog no. 33R-1551, is also available for use as a blocking control in assays to test for specificity of this KIAA0515 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0515 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRRC2B

Antigène: PRRC2B (Proline-Rich Coiled-Coil 2B (PRRC2B))

Autre désignation: KIAA0515 (PRRC2B Produits)

Synonymes: anticorps BAT2L, anticorps BAT2L1, anticorps KIAA0515, anticorps LQFBS-1, anticorps 5830434P21Rik, anticorps AI173903, anticorps Bat2l, anticorps Bat2l1, anticorps D430039P21, anticorps mKIAA0515, anticorps proline rich coiled-coil 2B, anticorps proline-rich coiled-coil 2B, anticorps PRRC2B, anticorps Prrc2b

Sujet: The function of KIAA0515 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome