STK32A anticorps (N-Term)

N° du produit ABIN632177

Détail du produit anti-STK32A anticorps

Antigène: STK32A (serine/threonine Kinase 32A (STK32A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STK32A est non-conjugé

Application: Western Blotting (WB)

Specificité: STK32 A antibody was raised against the N terminal of STK32

Purification: Affinity purified

Immunogène: STK32 A antibody was raised using the N terminal of STK32 corresponding to a region with amino acids GANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STK32A Blocking Peptide, catalog no. 33R-3165, is also available for use as a blocking control in assays to test for specificity of this STK32A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STK32A

Antigène: STK32A (serine/threonine Kinase 32A (STK32A))

Autre désignation: STK32A (STK32A Produits)

Synonymes: anticorps YANK1, anticorps A930015B13Rik, anticorps serine/threonine kinase 32A, anticorps STK32A, anticorps Stk32a

Sujet: STK32A belongs to the protein kinase superfamily, Ser/Thr protein kinase family. It contains 1 protein kinase domain. The function of the STK32A protein remains unknown.

Poids moléculaire: 20 kDa (MW of target protein)