EPB42 anticorps (Middle Region)
-
- Antigène Voir toutes EPB42 Anticorps
- EPB42 (erythrocyte Membrane Protein Band 4.2 (EPB42))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EPB42 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EPB42 antibody was raised against the middle region of EPB42
- Purification
- Affinity purified
- Immunogène
- EPB42 antibody was raised using the middle region of EPB42 corresponding to a region with amino acids ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP
- Top Product
- Discover our top product EPB42 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EPB42 Blocking Peptide, catalog no. 33R-4166, is also available for use as a blocking control in assays to test for specificity of this EPB42 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPB42 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EPB42 (erythrocyte Membrane Protein Band 4.2 (EPB42))
- Autre désignation
- EPB42 (EPB42 Produits)
- Synonymes
- anticorps PA, anticorps SPH5, anticorps Epb4.2, anticorps Epb42, anticorps erythrocyte membrane protein band 4.2, anticorps EPB42, anticorps Epb42
- Sujet
- Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia.
- Poids moléculaire
- 80 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-