TMOD3 anticorps
-
- Antigène Voir toutes TMOD3 Anticorps
- TMOD3 (Tropomodulin 3 (TMOD3))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMOD3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Tropomodulin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT
- Top Product
- Discover our top product TMOD3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Tropomodulin 3 Blocking Peptide, catalog no. 33R-4183, is also available for use as a blocking control in assays to test for specificity of this Tropomodulin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMOD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMOD3 (Tropomodulin 3 (TMOD3))
- Autre désignation
- Tropomodulin 3 (TMOD3 Produits)
- Synonymes
- anticorps TMOD3, anticorps tropomodulin-3, anticorps UTMOD, anticorps MGC53545, anticorps U-Tmod, anticorps tropomodulin 3, anticorps tropomodulin 3 S homeolog, anticorps TMOD3, anticorps Tmod3, anticorps tmod3.S, anticorps tmod3
- Sujet
- TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-