LYPLA2 anticorps (N-Term)

N° du produit ABIN632189

Détail du produit anti-LYPLA2 anticorps

Antigène: LYPLA2 (Lysophospholipase II (LYPLA2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYPLA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: LYPLA2 antibody was raised against the N terminal of LYPLA2

Purification: Affinity purified

Immunogène: LYPLA2 antibody was raised using the N terminal of LYPLA2 corresponding to a region with amino acids MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYPLA2 Blocking Peptide, catalog no. 33R-5812, is also available for use as a blocking control in assays to test for specificity of this LYPLA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPLA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LYPLA2

Antigène: LYPLA2 (Lysophospholipase II (LYPLA2))

Autre désignation: LYPLA2 (LYPLA2 Produits)

Synonymes: anticorps APT-2, anticorps DJ886K2.4, anticorps LysoII, anticorps MGC52664, anticorps MGC75683, anticorps LYPLA2P1, anticorps lysophospholipase II, anticorps lysophospholipase 2, anticorps lysophospholipase II S homeolog, anticorps LYPLA2, anticorps Lypla2, anticorps lypla2.S, anticorps lypla2

Sujet: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Poids moléculaire: 25 kDa (MW of target protein)